PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00047654001
Common NameGSBRNA2T00047654001, LOC106432143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 199aa    MW: 22191.5 Da    PI: 10.0084
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00047654001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof96.71.6e-302272656
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrr 56
                         + cprC+s+nt+fCyynnys+sqPry Ck+Crr Wt+GG+lrn+  Gg+r 
  GSBRNA2T00047654001 22 RICPRCNSDNTRFCYYNNYSVSQPRYTCKNCRRLWTHGGTLRNISAGGSRI 72
                         57********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-191970IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.4652276IPR003851Zinc finger, Dof-type
PfamPF027018.1E-282371IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MNKSRVLVRR NNQVSGVKPP PRICPRCNSD NTRFCYYNNY SVSQPRYTCK NCRRLWTHGG  60
TLRNISAGGS RIDQPSVAQV VPVETQQVNH HQTFLHGQET NDFLGSIGDS SSSAGVVGSH  120
FGSLPETHGD VVFPVRSHPP MNRPVFNDGS FPQGYYHVGH VNNYNSYRVN QEDPNKPRQR  180
FNNTMSMNHN TSTSGSRG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00047654001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728440.11e-145PREDICTED: dof zinc finger protein DOF4.3-like
SwissprotQ9SUA93e-54DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078GY481e-145A0A078GY48_BRANA; BnaC03g63990D protein
STRINGBra020910.1-P3e-91(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.12e-47Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]